CDS

Accession Number TCMCG067C42624
gbkey CDS
Protein Id KAF8055711.1
Location complement(join(42487..42567,42893..42988,43081..43197))
Organism Sinapis alba
locus_tag N665_1287s0010

Protein

Length 97aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA214277, BioSample:SAMN02744833
db_source MU106837.1
Definition hypothetical protein N665_1287s0010 [Sinapis alba]
Locus_tag N665_1287s0010

EGGNOG-MAPPER Annotation

COG_category A
Description Component of LSM protein complexes, which are involved in RNA processing. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by promoting decapping and leading to accurate 5'-3' mRNA decay. The cytoplasmic LSM1-LSM7 complex regulates developmental gene expression by the decapping of specific development-related transcripts. Component of the nuclear LSM2-LSM8 complex which is involved splicing nuclear mRNAs. LSM2-LSM8 binds directly to the U6 small nuclear RNAs (snRNAs) and is essential for accurate splicing of selected development-related mRNAs through the stabilization of the spliceosomal U6 snRNA. Plays a critical role in the regulation of development-related gene expression
KEGG_TC -
KEGG_Module M00354        [VIEW IN KEGG]
M00396        [VIEW IN KEGG]
M00397        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03019        [VIEW IN KEGG]
ko03041        [VIEW IN KEGG]
KEGG_ko ko:K12622        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03018        [VIEW IN KEGG]
ko03040        [VIEW IN KEGG]
map03018        [VIEW IN KEGG]
map03040        [VIEW IN KEGG]
GOs GO:0000375        [VIEW IN EMBL-EBI]
GO:0000377        [VIEW IN EMBL-EBI]
GO:0000398        [VIEW IN EMBL-EBI]
GO:0000932        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005681        [VIEW IN EMBL-EBI]
GO:0005688        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006397        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008380        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0030532        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033962        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0035770        [VIEW IN EMBL-EBI]
GO:0036464        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0046540        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0070925        [VIEW IN EMBL-EBI]
GO:0071011        [VIEW IN EMBL-EBI]
GO:0071013        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097525        [VIEW IN EMBL-EBI]
GO:0097526        [VIEW IN EMBL-EBI]
GO:0120114        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1990726        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCCGTCGAGGAAGACGCCACCGTTAGGGAGCCACTGGATCTGATTCGATTGAGTATCGAAGAGAGAATCTACGTCAAGCTCCGATCCGATCGTGAACTCCGCGGCAAGCTACACGCTTTTGATCAGCATTTGAATATGATTCTGGGTGATGTTGAAGAGGTTATCACTACTGTAGAAATCGACGACGAGACTTACGAAGAGATTGTTCGTACGTCGAAAAGAAAGATTCCGTTTCTATTTGTGAGAGGAGATGGAGTGATCTTGGTGTCGCCGCCTTTGAGGACTACTTGA
Protein:  
MSVEEDATVREPLDLIRLSIEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTVEIDDETYEEIVRTSKRKIPFLFVRGDGVILVSPPLRTT